Электронный журнал "Архитектура здоровья"
Категория: Обзоры и лекции

Автор: В.И. Швалев, В.П. Реутов, В.Б. Сергиенко, А.Н. Рогоза, В.П. Масенко

 

Введение

Начавшийся третий век истории развития медицины в Казанском университете [1, 36] характеризуется традиционным продолжением исследований нервной системы организма. Классические труды В.М. Бехтерева, Н.А. Миславского, П.Ф. Лесгафта, В.А. Энгельгардта, А.А. Баева, А.В. Кибякова, А.Д. Адо и нейрогистологической школы К.А. Арнштейна — работы А.Е. Смирнова, Д.А. Тимофеева, А.С. Догеля, А.Н. Миславского, Б.И. Лаврентьева, Н.Г Колосова и ГИ. Забусова — широко известны. В настоящее время в университете проводятся исследования стимулирования нейрорегуляторных процессов при участии генных нейротрофических факторов [27, 36]. В фундаментальной книге В.Ю. Альбицкого и соавт. [1] наряду с анализом этапов истории Казанского медицинского университета намечены первостепенные задачи его дальнейшего развития.

Известно, что этиопатогенез многих заболеваний связан с состоянием нервной системы. В кардиологии активно развивается направление «Мозг-сердце» и проводится изучение нарушений регуляторных влияний нервной системы в генезе сердечно-сосудистой патологии [13, 24-26]. Исследования возрастной иннервации внутренних органов, начиная с прошлого века, проводились в Казанском мединституте под руководством Н.А. Миславского [36]. В 1965 г. в Ленинграде под руководством казанца, профессора Н.Г Колосова и при участии профессора И.Т. Курцина была опубликована монография по иннервации сердца [28].

В продолжение работ, начатых в Казани, в последние десятилетия в лаборатории нейроморфологии кардиокомплекса в Москве был проведён нейрогистохимический и ультраструктурный анализ возрастных изменений иннервации сердца и кровеносных сосудов при различных заболеваниях [28-35].

 

Материалы и методы

Иммуногистохимическими методами изучена активность NO-синтазы в ганглиях сердца в норме и при патологии. Установлено, что в конце 2-го месяца развития в нервные терминали сердца и сосудов эмбриона проникают медиаторы — ацетилхолин и норадреналин [28]. Это дало основание считать, что с началом плодного периода на 3-м месяце беременности одновременно с образованием плаценты появляются адаптационно-трофические влияния нервных сплетений на развивающуюся сердечно-сосудистую систему (рис. 1, А). Таким образом, плодный период наряду с дифференцировкой центральной нервной системы характеризуется началом медиаторного этапа вегетативной нервной системы.

Морфофункциональный анализ развития иннервации сердечно-сосудистой системы наряду с традиционными нейрогистохимическими исследованиями казанских нейрогистологов [27, 28, 36] был проведён также в исследованиях А.Д. Ноздрачева и П.М. Маслюкова [9]. Необходимо отметить, что при детальном исследовании домедиаторного, медиаторного и постмедиаторного этапов возрастных преобразований регуляторных механизмов сердечно-сосудистой системы В.Н. Швалевым совместно с А.А. Сосуновым были выделены их последовательные стадии [34], а совместно с В.П. Реутовым установлено значение в динамике этих процессов изменений содержания в тканях сердца и сосудов синтазы оксида азота [35, 36].

Как показали работы казанского хирурга Л.М. Миролюбова [7], уже в пренатальном онтогенезе могут возникнуть предпосылки к сердечно-сосудистым заболеваниям. Курение, алкоголь, наркотики, а также продолжительные стрессовые состояния способны оказать патологическое влияние на пренатальное развитие ребёнка [23, 33].

Активное развитие нервного аппарата сердца происходит к периоду полового созревания, и в наибольшей степени концентрация афферентных и эфферентных сплетений определяется в сердце человека на втором и третьем десятилетиях (рис. 1, Б). Со стороны центральной нервной системы трофическая регуляция сердечно-сосудистой системы усиливается. Таким образом, взаимоотношения мозг-сердце человека в течение первых 30-40 лет жизни характеризуются оптимально высокой активностью, но затем наряду с возрастными изменениями нейронов центральной нервной системы происходит снижение деятельности соматического отдела периферической нервной системы. Как показали морфофункциональные исследования, это отчасти связано с уменьшением содержания медиаторов в симпатических сплетениях сердца и сосудов, однако одновременно возникает и нарастает компенсаторное повышение эндокринной регуляции кровеносной системы [5, 6, 21], хотя влияние вредных привычек при нарушениях морфофизиологии сердца и сосудов продолжает проявляться [13, 23, 24].

 

Рис. 1. Динамика возрастных изменений плотности адренергических нервных сплетений в миокарде левого желудочка сердца в пренатальном и постнатальном онтогенезе. А — 9-недельный плод человека (материал после аборта); Б — 32-летний мужчина; В — 64-летний мужчина (исследования сердец здоровых людей, погибших при катастрофах). Люминесцентная микроскопия. Увеличение х400.

 

Согласно нашим наблюдениям, полученным на большом материале ранних вскрытий здоровых людей, погибших в катастрофах, после 35-40 лет обнаруживаются нарушения нервной трофики сердечно-сосудистой системы. Они выражаются в нарастании с годами инволюционных изменений симпатического отдела вегетативной нервной системы [28-35]. Начальные реактивные изменения адренергических терминалей постепенно переходят к старости в деструктивные (рис. 1, В). Ультраструктурный анализ симпатических ганглиев показал нарастание их инволюционных изменений после 40-летнего возраста.

Сопутствующие изменения глиальных элементов свидетельствуют о возрастающей к старости инволюции нервных структур кровеносных сосудов и сердца, хотя парасимпатические сплетения изменяются медленнее [11, 37, 38, 40]. Рецепторы коронарных артерий также постепенно претерпевают реактивные, а затем дегенеративные изменения.

Одновременно, согласно закону Кеннона- Розенблюта [4], возникает и нарастает гуморальная компенсация процессов десимпатизации: происходит непрерывное увеличение количества адренорецепторов в тканях стенок сосудов и сердца и повышение их чувствительности к катехоламинам, что подтверждено физиологическими и биохимическими исследованиями [2, 3, 11, 15].

Ультраструктурные исследования, таким образом, показывают, что, начиная с четвёртого десятилетия жизни, происходят инволютивные изменения различных отделов нервной системы. Особенно они выражены в случаях внезапной сердечной смерти.

Мы провели по актуальной проблеме «внезапная смерть» многосторонние совместные исследования со специалистами США [32, 33]. Выполнены нейроморфологические исследования сердец в 73 случаях внезапной смерти в основном мужчин, возраст которых составлял 2560 лет, результаты сопоставлены с изучением 51 сердца здоровых людей (несчастные случаи).

 

Рис. 2. Состояние нейронов звёздчатого нервного узла при внезапной сердечной смерти. А — изменения в нейронах митохондрий с нарушениями крипт; выявляется терминаль рецептора, инвагинированная в нейрон и отличающаяся неизменёнными митохондриями. Мужчина 51 года. Б — заполнение изменяющихся митохондрий осми- офильным материалом в нейронах звёздчатого нервного узла при внезапной сердечной смерти. Мужчина 54 лет.

 

Как правило, при внезапной смерти обнаруживались очаговые нарушения состояния симпатических нервных сплетений сердца, особенно в синусовом узле (рис. 2) и по протяжению проводящей системы. Возникающая вследствие резкой неравномерности морфологии нервного аппарата сердца нестабильность его нервной регуляции, несомненно, способствовала частому сокращению миокарда — фибрилляции желудочков сердца.

Внезапное нарушение кровообращения в организме тотчас сказывается на состоянии головного мозга. Анализ периферической нервной системы — морфологии вегетативных ганглиев (рис. 3) — позволил выявить у внезапно умерших изменения состояния нервных компонентов, особенно симпатической нервной системы [31].

 

Рис. 3. Изменения терминален нервных волокон в синоаурикулярнои зоне сердца при внезапной сердечной смерти. А — тёмная деструкция нервных терминалей в синусовом узле сердца мужчины 54 лет. Б — светлая форма деструкции безмякотного нервного волокна в синусовом узле мужчины 55-летнего возраста.

 

При внезапной смерти одновременно определялись зоны поражения нервных элементов при морфобиохимическом исследовании важнейшего центра регуляции внутренних органов — гипоталамуса, наряду с обнаружением очаговой дегенерации нервного аппарата сердца было установлено нарушенное соотношение катехоламинов в гипоталамусе. В составе гипоталамических ядер доминировал адреналин, в то время как в норме в них преобладает норадреналин [31, 32].

Раннее возрастное снижение влияния симпатической нервной системы на сердечно-сосудистую систему было подтверждено при диагностике начальных стадий гипертонической болезни. Сравнительное изучение функциональных возрастных изменений нервной регуляции сердца было выполнено Н.А. Тарским у здоровых людей в возрасте с 18 до 71 года и у страдающих гипертонической болезнью [21, 33]. Им было выявлено выраженное снижение низкочастотной мощности кардиоинтервалов по мере старения после 40 лет.

В отделе новых методов диагностики изучались возрастные изменения нервной регуляции кровеносных сосудов в кардиологической практике в сочетании с морфологическими исследованиями [17, 18, 21, 33]. С помощью ультразвуковых методов выявлялись ранние поражения стенок сонных артерий. Применялись неинвазивные способы определения жёсткости (ригидности) магистральных артерий, внедрялось автоматизированное решение нового алгоритма для оперативности получения данных.

 

Результаты и обсуждение

В результате изучения барорефлекторной регуляции артерий обнаружено, что у 35-70-летних пациентов, страдающих мягкой формой гипертонической болезни при сочетании с атеросклеротическими поражениями сонных артерий, происходят ослабление синокаротидного барорефлекса и увеличение вариабельности суточного ритма артериального давления. При умеренной форме гипертонической болезни у пациентов определялись отрицательные возрастные корреляционные связи между вариабельностью артериального давления и эффективностью синокаротидного барорефлекса.

Работами С.П. Голицына и А.Н. Рогозы было установлено, что дефицит симпатического звена регуляции сердечно-сосудистой системы, проявляющийся наличием зон десимпатизации миокарда, наблюдается у большинства больных вазовагальными обмороками. После 35-40-летнего возраста у больных нарастает снижение барорефлекторной активности, возникают нарушения системы «мозг-сердце». Раннее возникновение нейрогенных нарушений при сердечных заболеваниях, найденные при нейрогистохимических исследованиях сердечно-сосудистой системы в онтогенезе, получили подтверждение при изучении возрастных изменений вариабельности сердечного ритма [17, 18, 21, 35].

В настоящее время внимание клиницистов привлекает изучение циклических превращений оксида азота в организме млекопитающих [12, 14, 15]. В.П. Реутовым были впервые сформулированы и обоснованы концепции циклов оксида азота и супероксидного анион-радикала [14], была высказана гипотеза о том, что фактором защиты клеток и субклеточных структур от свободных радикалов азота и кислорода служит циклическая организация этих радикалов. При нарушении указанных циклов могут образовываться пероксинитриты, которые способны распадаться с образованием диоксида азота (NO2) и ОН-радикалов [15, 16].

Эти чрезвычайно активные соединения могут быть факторами повреждения клеточных и субклеточных мембран и способствовать выходу протеаз и фосфолипаз из мембран клеток и субклеточных структур, вызывая расщепление белков цитоплазмы клеток сосудов, фосфолипидов мембран и накопление в них липоидов. В связи с этим в организме плода и у новорождённого при наличии воспалительных процессов и гипоксических состояний возникают условия для появления липоидных образований, которые могут в дальнейшем привести к появлению в сосудах предшественников атеросклеротических бляшек. Оксид азота выделяется эндотелием на протяжении всей жизни.

Возникают вопросы: каковы механизмы развития инволюции адренергических сплетений сердца и являются ли эти изменения нервной регуляции сердечно-сосудистой системы причиной её основных заболеваний — гипертонической болезни и атеросклероза? Циклы оксида азота и супероксидного анион-радикала в зрелом и пожилом возрасте могут нарушаться при ишемических и гипоксических состояниях, вследствие чего возникают условия для формирования атеросклеротических бляшек [16, 34, 35].

Вместе с тем, пока в стенке сосудов сохраняются нервные волокна, выделяющие норадреналин и другие медиаторы, являющиеся фенолами биологического происхождения, атеросклеротические бляшки развиваются медленно, поскольку биофенолы — антиоксиданты, обладающие антирадикальными свойствами. По мере нарастания инволюции адренергических нервных волокон в интиме сосудов образование атеросклеротических бляшек активируется [16, 35].

Известно, что изменения регуляции мозговой гемодинамики взаимозависимы с эндотелиальными нарушениями. Патологические изменения системы мозг-сердце, таким образом, выявляются при основных сердечно-сосудистых заболеваниях в связи с нарушениями синтеза медиаторов нервной системы в онтогенезе, а также с изменениями взаимовлияния активных форм азота и кислорода и продуктов их взаимодействия (NO2) с адренергическими нервными волокнами [19, 39].

Исследования нервной регуляции сердца при высоких социальных нагрузках окружающей среды весьма актуальны [13, 25, 36]. А.Л. Мясников характеризовал гипертоническую болезнь как заболевание, вызванное «первичными нарушениями корковой и подкорковой регуляции вазомоторной системы в результате расстройства высшей нервной деятельности с последующим вовлечением в патогенетический механизм гуморальных факторов» [8]. Выдающийся кардиолог пришёл к выводам: «гипертоническая болезнь и атеросклероз начинаются в более раннем возрастном периоде, чем обычно считают» и «в патогенезе гипертонической болезни и атеросклероза имеются общие начальные звенья (первичные нарушения со стороны регулирующих сосудистый тонус и сосудистую трофику нервных приборов)» [8].

Характеризуя общность развития гипертонической болезни и атеросклероза, А.Л. Мясников пишет: «Исходный источник патологического процесса при той и другой болезни сосредоточен в центральной нервной системе и по своему происхождению и характеру состоит в нарушении высшей нервной деятельности и подкорковой регуляции. Далее выступает звено вегетативной нервной системы с избыточным раздражением преимущественно симпатического её отдела. Затем участвует гормональная часть этого аппарата — реакция со стороны мозгового слоя надпочечника и других отделов хромаффинной системы, продуцирующая катехоламины. Как гипертония, так и атеросклероз протекают под знаком чрезмерной симпато-адреналовой активности» [8].

Крупным вкладом в учение о нейрогенной природе кардиологических заболеваний стали исследования руководителя отдела радионуклидной диагностики кардиокомплекса профессора В.Б. Сергиенко и сотрудника А.А. Аншелеса [19, 20]. Ими убедительно подтверждена высокая значимость для кардиологов анализа преобразований, регулирующих влияние определённых отделов головного мозга.

Радиодиагностические исследования с нейротропными препаратами показали возможность раннего выявления нарушений симпатической иннервации миокарда при гипертонической болезни, атеросклерозе, кардиомиопатиях и аритмиях. Установлены преимущества применения в клинике диагностической сцинтиграфии с радиофармпрепаратом 123I-мета-йод-бензилгуанидином (123I-МИБГ) как высокоинформативного метода оценки состояния симпатической иннервации миокарда.

Исходя из особенностей фармакокинетики включения 123I-МИБГ в миокард, являющегося аналогом норадреналина, после его внутривенного введения при радионуклидном исследовании появилась возможность оценки плотности адренергических сплетений миокарда. Было показано, что восстановление иннервации миокарда после острого инфаркта миокарда значительно замедлено по сравнению с восстановлением перфузии [20, 35]. У больных с коронарным атеросклерозом были найдены повреждения симпатических нейронов при начальной ишемии миокарда.

 

Рис 4. Радионуклидная диагностика перфузии и плотности адренергических нервных сплетений миокарда с помощью радионуклидной диагностики при остром инфаркте миокарда: 1 — через 1 мес; 2 — через 8 мес после начала заболевания. А — иннервация с 123I-МИБГ. Б — перфузия с 99mТс-МИБИ; отчётливо определяется увеличение зоны нарушения иннервации сердца, несмотря на восстановление перфузии.

 

Применение радионуклидных визуализирующих методов важно при дилатационной кардиомиопатии, поскольку раздражение симпатической системы при прогрессировании данного заболевания стимулирует хроническую сердечную недостаточность [20, 35]. Таким образом, при использовании радионуклидных методов исследования появилась возможность определить степень адаптационно-трофических воздействий на иннервацию миокарда при различных видах сосудистой патологии (рис. 4) [19, 20].

Доказано, что при изучении симпатической иннервации сердца важно выявление участков миокарда с нарушением функций симпатических окончаний, а также определение их количества и степени влияния на сердце. Так, у больных вазовагальными обмороками по данным томосцинтиграфии миокарда с 123I-МИБГ отчётливо выявляются нарушения региональной симпатической активности миокарда левого желудочка, которые на сцинтиграммах визуализируются как участки сниженного накопления радиофармпрепарата различной степени выраженности и распространённости [20, 35].

В современной ядерной медицине продолжают разрабатывать новые радиофармпрепараты с целью диагностики состояния пре- и постсинаптических компонентов парасимпатической иннервации сердца. Показано, к примеру, что позитронная эмиссионная томография при исследовании с меченым 18F-фаллипридом позволяет визуализировать повышенную дофаминовую активность и количественно рассчитать динамику его выведения из различных структур мозга [35]. При этом возможна оценка особенности включения меченого радиофармпрепарата в полосатое тело, бледный шар среднего мозга (включая чёрную субстанцию) и лимбические области головного мозга (рис. 5).

 

Рис. 5. Позитронно-эмиссионная компьютерная томограмма головного мозга с радиофармпрепаратом 18Т-фаллипридом. А — исследование при посредстве радионуклидной диагностики дофаминергической активности в покое. Б — на фоне введения агониста дофамина.

 

В рамках изучения системы мозг-сердце активно развиваются радионуклидные методы диагностики и оценки прогноза артериальной гипертензии. Исследованиями отдела радионуклидной диагностики и отдела гипертонии кардиокомплекса впервые показаны возможности однофотонной эмиссионной томографии в выявлении нарушений перфузии головного мозга после провоцирующих проб с диамоксом у пациентов с артериальной гипертензией (рис. 6) [20].

 

Рис. 6. Перфузионная однофотонно-эмиссионная компьютерная томограмма головного мозга у больного с артериальной гипертензией. А — исследование в покое. Б — исследование после пробы с диамоксом, выявляются преходящие дефекты перфузии коры головного мозга (стрелки).

 

Анализ вазовагального синдрома выявил дисфункцию гипофизарно-надпочечниковой и ренинальдостероновой систем. Исследования В.П. Масенко иммунных систем при развитии депрессивных состояний [6] отмечены Е.И. Чазовым, подчеркнувшим, что «Методические возможности медицинской науки ХХ века раскрыли не только разнообразие регуляторных механизмов — нейрогенных, гормональных, рецепторных, мембранных, но и показали всю сложность их функционирования и взаимозависимости. Они, как и целый ряд других регуляторных систем — иммунной, антикоагулянтной, фибринолитической и других, определяют защиту организма от вредоносных влияний среды» [26].

Чрезвычайно важная задача в разрешении проблемы мозг-сердце — пересадка сердца и необходимость восстановления его иннервационных регуляторных связей. Как известно, при трансплантации сердца в нём остаются лишь единичные рефлекторные дуги, спонтанная реиннервация органа происходит крайне медленно, поэтому перспективна детальная разработка методов его реиннервации [22]. Активное восстановление полноценной регуляции сердца — основная задача при конструировании искусственных стимуляторов органа.

Углублённые исследования системы мозг-сердце в начале XXI века при высоких социальных нагрузках, прежде всего на центральную нервную систему, весьма перспективны. Состояние «стражей сердечных тайн» — нервных сплетений сердца — постоянно изучают кардиологи, так как существенным фактором прогрессирования сосудистых заболеваний является состояние депрессии [6, 13, 25]. Е.И. Чазов, подчёркивая, что депрессивная симптоматика встречается у многих пациентов (до 60%) с хронической сердечной недостаточностью, отметил: «она встречается чаще, чем при другом хроническом заболевании, даже онкологическом» [26].

Приходится, однако, констатировать, что состояние центральной и вегетативной нервной системы в процессе старения ещё недостаточно оценивается в практической медицине. Кардиологи при анализе жалоб на характер болей у пациентов не всегда консультируются с вегетоневрологами.

Как известно, исходя из классических трудов Кеннона и Розенблюта, в результате десимпатизации сердца и сосудов происходит «повышение чувствительности денервированных структур» [4]. Адренореактивность тканей в десимпатизированных тканях нарастает, компенсаторно увеличивается гуморальная регуляция сердечнососудистой системы. В связи с этим назначение пациенту адреноблокаторов направлено не на мнимое снижение «повышенной активности симпатоадреналовой системы», как ошибочно продолжают утверждать некоторые кардиологи [10]. Вводимые медикаменты обеспечивают блокаду возрастающего в онтогенезе количества адренорецепторов в связи с проявлениями феномена ранних инволюционных изменений симпатического отдела вегетативной нервной системы [4, 28].

 

Заключение

Таким образом, фундаментальными и перспективными направлениями в развитии кардиологии в настоящее время являются проблемы углублённого изучения этапов онтогенеза системы мозг-сердце, усложняя морфофункциональные исследования изменений состояния нервной системы при кардиологических заболеваниях. Сегодня перспективно детальное изучение возрастной регуляции сердечно-сосудистой системы в аспекте возможных изменений генетического кода организма при реализации планируемых космических полётов.

 

Литература:

1. Альбицкий В.Ю., Амиров Н.Х., Созинов А.С., Галлямов А.Б. История Казанского государственного медицинского университета. Казань: Магариф. 2006; 373 с. [Al’bitskiy V.Yu., Amirov N.Kh., Sozinov A.S., Gallyamov A.B. Istoriya Kazanskogo gosudarstvennogo meditsinskogo universiteta. (History of Kazan State Medical University.) Kazan: Magarif. 2006; 373 p. (In Russ.)]

2. Говырин В.А. Трофическая функция симпатических нервов сердца и скелетных мышц. Л.: Наука. 1967; 130 с. [Govyrin V.A. Troficheskaya funktsiya simpaticheskikh nervov serdtsa i skeletnykh myshts. (Trophic function of the sympathetic nerves of the heart and skeletal muscles.) Leningrad: Nauka. 1967; 130 p. (In Russ.)]

3. Гомазков О.А. Нейротрофическая регуляция и стволовые клетки мозга. М.: Икар. 2006; 332 с. [GomazkovO.A. Neyrotroficheskayaregulyatsiyaistvolovyekletkimozga. (Neurotrophic regulation and brain stem cells.) Moscow: Ikar. 2006; 332 p. (In Russ.)]

4. Кеннон В., Розенблют А. Повышение чувствительности денервированных структур. Законденервации. М.: Издательствоиностраннойлитературы. 1951; 262 с. [Cannon W.B., Rosenblueth A. The supersensitivity of denervated structures: a law of denervation. New York: The MacMillan Company, 1949. Russ. ed.: Cannon W.B., Rosenblueth A. Povyshenie chuvstvitel’nosti denervirovannykh struktur. Zakon denervatsii. Moscow: Izdatel’stvo inostrannoy literatury. 1951; 262 p. (In Russ.)]

5. Лепехина Л.М. Адаптационно-трофическое влияние шейных симпатических ганглиев в онтогенезе. Л.: Наука. 1984; 170 с. [LepekhinaL.M. Adaptatsionno- troficheskoevliyaniesheynykhsimpaticheskikhganglievvontogeneze. (Adaptive and trophic influence of cervical sympathetic ganglia in ontogeny.) Leningrad: Nauka. 1984; 170 p. (In Russ.)]

6. Масенко В.П., Бурячковская Л.И. Депрессия, воспаление и тромбоз. Природа. 2005; (10): 23-25. [Ma- senko V.P., Buryachkovskaya L.I. Depression, Inflammation and Thrombosis. Priroda. 2005; (10): 23-25. (In Russ.)]

7. Миролюбов Л.М. Врождённые пороки сердца у новорождённых и детей первого года жизни. Казань: Медицина. 2008; 150 с. [Mirolyubov L.M. Vrozhdennye poroki serdtsa u novorozhdennykh i detey pervogo goda zhizni. (Congenital heart defects in newborns and infants.) Kazan: Meditsina. 2008; 150 p. (In Russ.)]

8. Мясников А.Л. Гипертоническая болезнь и ате- росклероз. М.: Медицина. 1965; 615 с. [Myasnikov A.L. Gipertonicheskaya bolezn’ i ateroskleroz. (Hypertensive heart disease and atherosclerosis.) Moscow: Meditsina. 1965; 615 p. (In Russ.)]

9. Ноздрачев А.Д., Маслюков П.М. Возрастное развитие нейронов автономных ганглиев. СПб.: ИнформНавигатор. 2014; 320 с. [Nozdrachev A.D., Maslyukov P.M. Vozrastnoe razvitie neyronov avtonomnykh gangliev. (Age development of autonomic ganglia neurons.) St. Petersburg: Inform-Navigator. 2014; 320 p. (In Russ.)]

10. Ольбинская Л.И. Метаболический синдром у больных с хронической сердечной недостаточностью: подходы к лечению. Серд. недостат. 2003; (1): 12-14. [Ol’binskaya L.I. Metabolic syndrome in patients with congestive heart failure: treatment approaches. Zhurnal serdechnaya nedostatochnost’. 2003; (1): 12-14. (In Russ.)]

11. Орбели Л.А. О трофических функциях вегетативной нервной системы. Избранные труды. М.-Л. 1961; 1: 182-188. [Orbeli L.A. O troficheskikh funktsiyakh vegetativnoy nervnoy sistemy. Izbrannye trudy. (On trophic functions of the autonomic nervous system. Selected works.) Moscow. Leningrad. 1961; 1: 182-188. (In Russ.)]

12. Пинелис В.Г, Сорокина Е.Г, Реутов В.П. и др. Влияние токсического воздействия глутамата и нитрита на содержание циклического ГМФ в нейронах и их выживаемость. Докл. АМН СССР. 1997; (2): 256-261. [Pinelis V.G., Sorokina E.G., Reutov V.P et al. Influence of the toxic effects of nitrite and glutamate on cyclic GIMP content in neurons and their survival. Reports of the Academy of Medical Sciences of the USSR. 1997; (2): 256-261. (In Russ.)]

13. Погосова ГВ. Депрессия — фактор развития ишемической болезни сердца и предиктор коронарной смерти. 10 летнаучногопоиска. Кардиология. 2012; (12): 4-11. [Pogosova G.V. Depression — a risk factor for coronary heart disease and a predictor of coronary death: 10 years of scientific research. Kardiologiya. 2012; (12): 4-11. (In Russ.)]

14. Реутов В.П. Медико-биологические аспекты циклов оксида азота и супероксидного анион-радикала. Вестн. РАМН. 2000; (4): 35-41. [Reutov V.P Medical and biological aspects of nitric oxide and superoxide anion radical cycles. VestnikRossiyskoy akademii meditsinskikh nauk. 2000; (4): 35-41. (In Russ.)]

15. РеутовВ.П., ОрловС.Н. Физиологическоезначениегуанилатциклазыирольокисиазотаинитритсоединенийврегуляцииактивностиэтогофермента. Физиол. человека. 1993; 19 (1): 124-127. [Reutov V.P, Orlov S.N. The physiological importance of guanylyl cyclase and the role of nitric oxide and nitrite compounds in regulating the activity of this enzyme. Fiziologiya cheloveka. 1993; 19 (1): 124-127. (In Russ.)]

16. РеутовВ.П., СорокинаЕ.Г, ШвалевВ.Н. идр. Возможная роль диоксида азота, образующегося в местах бифуркации сосудов, в процессах их повреждения при геморрагических инсультах и образовании атеросклеротических бляшек. Успехи физиол. наук. 2012; (4): 73-93. [ReutovV.P., SorokinaE.G., ShvalevV.N. etal. The possible role of nitrogen dioxide produced in the field of bifurcation of vessels, in the processes of their damage in hemorrhagic strokes, and the formation of atherosclerotic plaques. Uspekhi fiziologicheskikh nauk. 2012; (4): 73-93. (In Russ.)]

17. РогозаА.Н., БабаевА.А., ПанфиловВ.В., Ать- ковО.Ю. Барорецепторнаярегуляцияуздоровыхлицибольныхгипертоническойболезнью. Кардиология. 1990; (3): 26-30. [Rogoza A.N., Babaev A.A., Panfilov V.V., At’kov O.Yu. Pressosensitive regulation in healthy individuals and hypertensive patients. Kardiologiya. (In Russ.)]

18. Рогоза А.Н., Балахонова Т.В., Чихладзе Н.М. и др. Современные методы оценки состояния сосудов у больных артериальной гипертонией. Пособие для практикующих врачей. М.: Атмосфера. 2008; 39 с. [Rogoza A.N., Balakhonova T.V., Chikhladze N.M. et al. Sovremennye metody otsenki sostoyaniya sosudov u bol’nykh arterial’noy gipertoniey. (Modern methods of evaluation of the state of blood vessels in patients with arterial hypertension.) Handbook for practitioners. Moscow: Atmosfera. 2008; 39 p. (In Russ.)]

19. СергиенкоВ.Б., АншелесА.А. Радионуклиднаядиагностикаснейротропнымирадиопрепаратами. М.: Инфра-М. 2014; 112. [Sergienko V.B., Ansheles A.A. Radionuklidnaya diagnostika s neyrotropnymi radioprepa- ratami. (Radionuclide diagnostics with radiologocal neurotropic agents.) Moscow: Infra-M. 2014; 112. (In Russ.)]

20. Сергиенко В.Б., Аншелес А.А., Шульгин Д.Н. и др. Методические рекомендации: перфузионная сцин- тиграфия и ОЭКТ миокарда. Кардиол. вестн. 2015; (2): 6-21. [SergienkoV.B., AnshelesA.A., ShulginD.N. etal. Methodical recommendations Perfusion scintigraphy and OECT of the myocardium. Kardiologicheskiy vestnik. 2015; (2): 6-21. [ (In Russ.)]

21. Тарский Н.А., Швалев В.Н., Салтыков С.Ю. и др. Особенности время-частотного спектрального анализа сердечного ритма у здоровых лиц и больных с артериальной гипертензией при проведении ортостатической пробы. Кардиология. 2000; (4): 40. [Tarskiy N.A., Shvalev V.N., Saltykov S.Yu. et al. Features of the time-frequency spectral analysis of heart rate in healthy individuals and patients with hypertension during the orthostatic test. Kardiologiya. 2000; (4): 40. (In Russ.)]

22. Тренин С.О., Колесников Л.Л. Морфо-экспериментальные аспекты реиннервации пересаженного сердца. М. 1995; 184 с. [Trenin S.O., Kolesnikov L.L. Morfo-eksperimental’nye aspekty reinnervatsii peresazhennogo serdtsa. (Morphological and experimental aspects of reinnervation of the transplanted heart.) Moscow. 1995; 184 p. (In Russ.)]

23. Фролькис В.В. Старение и увеличение продолжительности жизни. Л.: Наука. 1988; 239 с. [Frol’kis V.V. Starenie i uvelichenie prodolzhitel’nosti zhizni. (Aging and increase in life expectancy.) Leningrad: Nauka. 1988; 239 p. (In Russ.)]

24. Чазов Е.И. Роль нарушений регуляторных механизмов в формировании заболеваний сердечнососудистой системы. Терап. вестн. 1999; (9): 8-14. [Chazov E.I. Role of regulatory mechanisms disturbances in the formation of cardiovascular system diseases. Terapevticheskiy vestnik. 1999; (9): 8-14. (In Russ.)]

25. Чазов Е.И. Депрессия как фактор развития и прогрессирования сердечно-сосудистых заболеваний. Ж. серд. недостат. 2003; (1): 6-8. [Chazov E.I. Depression as cardiovascular disease development and progression factor. Zhurnal Serdechnaya Nedostatochnost’. 2003; (1): 6-8. (In Russ.)]

26. Чазов Е.И. Дизрегуляция и гиперреактивность организма как факторы формирования болезни. Карди- ол. вестн. 2006; (1): 5-9. [Chazov E.I. Dysregulation and hyperreactivity of the body as the factors of the disease formation. Kardiologicheskiy vestnik. 2006; (1): 5-9. (In Russ.)]

27. Челышев Ю.А., Рагинов И.С. Чувствительные нейроны и шванновские клетки при фармакологической стимуляции регенерации нерва. Морфология. 2000; (6): 36-40. [Chelyshev Yu.A., Raginov I.S. Sensory neurons and Schwann cells in the pharmacological stimulation of nerve regeneration. Morfologiya. 2000; (6): 36-40. (In Russ.)]

28. Швалев В.Н., Сосунов А.А., Гуски Г. Морфологические основы иннервации сердца. М.: Наука. 1992; 366 с. [Shvalev V.N., Sosunov A.A., Guski G. Morfologicheskie osnovy innervatsii serdtsa. (Morphological bases of cardiac innervation.) Moscow: Nauka. 1992; 366 p. (In Russ.)]

29. Швалев В.Н. Молодость и сердце. М.: Молодая гвардия. 1981; 176 с. [Shvalev V.N. Molodost’ i serdtse. (Youth and heart.) Moscow: Molodaya gvardiya. 1981; 176 p. (In Russ.)]

30. Швалев В.Н. Нервная система и заболевания сердца. М.: Медицина. 1983; 72 с. [Shvalev V.N. Nervnaya sistema i zabolevaniya serdtsa. (The nervous system and heart disease.) Moscow: Meditsina. 1983; 72 p. (In Russ.)]

31. Швалев В.Н., Стропус РА., Абрайтис РИ. и др. Нейрогуморальные нарушения в сердце и его интра- и экстраорганном нервном аппарате при внезапной сердечной смерти в сопоставлении с возрастным содержанием в этих отделах медиаторов нервной системы. Материалы 2-го советско-американского симпозиума, 6-8 декабря 1979 г. Индианополис (США), М.: Медицина. 1982; 226-250. [Shvalev V.N., Stropus R.A., Abraytis R.I. et al. Neyrogumoral’nye narusheniya v serdtse i ego intra- i ekstraorgannom nervnom apparate pri vnezapnoy serdechnoy smerti v sopostavlenii s vozrastnym soderzhaniem v etikh otdelakh mediatorov nervnoy sistemy. (Neurohumoral disturbances in the heart and its intra- and extraorgan nerve system in sudden death compared with the amount of nervous system mediators in these regions as a function of age.) Proceedings of the 2nd USA-USSR Joint Symposium, December 6-8, 1979. Indianapolis (USA), Moscow: Meditsina. 1982; 226-250. (In Russ.)]

32. Швалев В.Н., Вихерт А.М., Стропус РА. и др. Изменения нервных и гуморальных механизмов сердца при внезапной сердечной смерти в связи с предшествующей патологией миокарда. Материалы 4-го советско-американского симпозиума, 7-10 апреля 1985 г. Бирмингем, Алабама (США), Вильнюс: Мокслас. 1987; 54-73. [Shvalev V.N., Vikhert A.M., Stropus R.A. et al. Izmeneniya nervnykh i gumoral’nykh mekhanizmov serdtsa pri vnezapnoy serdechnoy smerti v svyazi s predshestvuyushchey patologiey miokarda. (Changes in nervous and humoral mechanisms of the heart in the of sudden death due to previous myocardial pathology.) Proceedings of the 4th USA- USSR Joint Symposium, April 7-10, 1985, Birmingham, Alabama (USA), Vilnius: Mokslas. 1987; 54-73. (In Russ.)]

33. Швалев В.Н., Тарский Н.А. Морфологические и функциональные трансформации симпатоадренало- вой системы при старении как фактор риска сердечно-сосудистых заболеваний. Вестн. РАЕН. 2005; (1): 48-54. [Shvalev V.N., Tarskiy N.A. Morphological and functional transformation sympathoadrenal system during aging as cardiovascular disease risk factor. Vestnik RAEN. 2005; (1): 48-54. (In Russ.)]

34. Швалев В.Н., Сосунов А.А. Этапность преобразований вегетативной нервной системы в онтогенезе. АрхивАГЭ. 1989; XCTI (5): 5-17. [Shvalev V.N., Sosunov A.A. Stages of transformation of the autonomic nervous system in ontogenesis. Arkhiv AGE. 1989; XCTI (5): 5-17. (In Russ.)]

35. Швалев В.Н., Реутов В.П., Рогоза А.Н. и др. Морфофункциональные исследования нейрогенной природы заболеваний сердечно-сосудистой системы. Морфол. ведомости. 2014; (1): 6-20. [ShvalevV.N., ReutovV.P., RogozaA.N. etal. Development of the doctrine of the neurogenic nature of heart disease in the aspect of new studies of regulatory mechanisms of the cardiovascular system. Morfologicheskie vedomosti. 2014; (1): 6-20. (In Russ.)]

36. Швалев В.Н., Рогоза А.Н., Реутов В.П. и др. Развитие традиций Казанской медицинской школы — изучение морфологических основ нервной трофики. Казанский мед. ж. 2014; (2): 175-180. [Shvalev V.N., Rogoza A.N., Reutov V.P. et al. Studies of neurotrophism morphological basis - developing traditions of Kazan medical school. Kazanskiy meditsinskiy zhurnal. 2014; (2): 175-180. (In Russ.)]

37. Ardell J.L., Massari V.J. Parasympathetic control of the heart. III Neuropeptide Y-immunoreactive nerve terminals synapse on three populations of negative chronotropic vagal preganglionic neurons. J. Fppl. Phisiol. 2004; 96: 2279-2287.

38. Bibevski S., Zhou Y., McIntosh J.M. et al. Functional nicotinic acetylcholine receptors that mediate ganglionic transmission in cardiac parasympathetic neurons. J. Neurosci. 2000; 20 (13): 5076-5082.

39. Fostermann U., Boissel J.P., Kleinert H. Expressional control of the costutitive isoforms of nitric oxide syntase (NOS I and NOS III). FASEB J. 1998; 12 (10): 773-790.

40. Robertson O., Biaggioni I. Dissorders of the autonomic nervous system. Harwood acad. Publ. GmbH.

 

 

Источник: Казанский медицинский журнал, 2016 г., том 97, №4

Чтобы оставить комментарий, Вам необходимо авторизоваться (либо зарегистрироваться)

Комментарии

  • Комментариев пока нет